PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do027609.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NF-YC
Protein Properties Length: 79aa    MW: 8753.53 Da    PI: 4.017
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do027609.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC61.81.4e-197614599
       NF-YC 45 vllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99
                 l++ acelfi elt r+w  + e krrt++k d++ av++td fdflvdiv  +
  Do027609.1  7 WLYCSACELFITELTRRAWAXTLEGKRRTVHKEDVSVAVQNTDLFDFLVDIVMVE 61
                68899**********************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.57E-14358IPR009072Histone-fold
Gene3DG3DSA:1.10.20.106.1E-17658IPR009072Histone-fold
PfamPF008087.3E-81145IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 79 aa     Download sequence    Send to blast
MADENFWLYC SACELFITEL TRRAWAXTLE GKRRTVHKED VSVAVQNTDL FDFLVDIVMV  60
EAGGAGHAVA GDDDDGVLE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9582364e-42EU958236.1 Zea mays clone 1680099 nuclear transcription factor Y subunit C-9 mRNA, complete cds.
GenBankHQ2345024e-42HQ234502.1 Zea mays clone BAC ZMMBBb0342E21 DNA-binding protein, peroxisomal-CoA synthetase, cleavage and polyadenylation specificity factor 5, DNA mismatch repair protein, and putative potassium efflux system protein family genes, complete cds; and unknown gene.
GenBankKJ7270094e-42KJ727009.1 Zea mays clone pUT3990 CCAAT-HAP5 transcription factor (CA5P1) gene, partial cds.
GenBankKJ7270104e-42KJ727010.1 Zea mays clone pUT3991 CCAAT-HAP5 transcription factor (CA5P2) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006653894.18e-26PREDICTED: nuclear transcription factor Y subunit C-2-like
SwissprotQ9ZVL32e-16NFYC3_ARATH; Nuclear transcription factor Y subunit C-3
TrEMBLA0A0D9WBC42e-26A0A0D9WBC4_9ORYZ; Uncharacterized protein
STRINGBGIOSGA014063-PA3e-25(Oryza sativa Indica Group)
STRINGOB04G37010.12e-25(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP116583339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56170.21e-16nuclear factor Y, subunit C2